Free release

acth [1-39] peptide

Service@apichina.com
Synonyms adrenocorticotropic hormone; acth; corticotropin
Sequence Human: H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH or H-SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF-OH
Molecular Formula C207H308N56O58S1
Molecular Weight 4541.1 g/mol
Purity Purity > 95% by HPLC
Format Each vial contains 1 mg of lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt.
Solubility Distilled water for a solution up to 2 mg/ml, otherwise we recommend using acetonitrile.
Storage Store at -20°C. The product is hygroscopic and must be protected from light. Product is guaranteed one year from the date of shipment. Following reconstitution, aliquot and store at -20°C.
description adrenocorticotropic hormone (acth), also known as corticotropin, is produced and secreted by the anterior pituitary gland. acth is an important component of the hypothalamic-pituitary-adrenal axis as a response to biological stress. acth secretion is triggered by the corticotropin-releasing hormone (crh) released from the hypothalamus, and stimulates the adrenal glands to release corticosteroids such as cortisol. acth [1-39] corresponds to full-length acth. acth [1-24] is conserved across species and is 75% as potent as acth. acth [1-10] has no acth activity but alter blood pressure. acth [4-10] has neurological effects.

How to place a order:

1) Contact us at: Service@apichina.com ;
2) Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3) Place us a purchaser order, we can send you a sales contract too if you need;
4) Start synthesis, and we will inform you the updates of synthesis in time;
5) Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6) Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them;
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.