| Synonyms | |
| Sequence | Human: H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 or H-YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2 |
| Molecular Formula | C189H285N55O57S1 |
| Molecular Weight | 4271.78 g/mol |
| Purity | Purity > 95% by HPLC |
| Format | Each vial contains 1 mg of lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt. |
| Solubility | Distilled water for a solution up to 2 mg/ml, otherwise we recommend using acetonitrile. |
| Storage | Store at -20°C. The product is hygroscopic and must be protected from light. Product is guaranteed one year from the date of shipment. Following reconstitution, aliquot and store at -20°C. |
| description | neuropeptide y (npy) is a 36-aa neuropeptide that acts as a neurotransmitter in the brain and in the autonomic nervous system of humans. in the autonomic system, npy is produced mainly by neurons of the sympathic nervous system and serves as a strong vasoconstrictor and also causes growth of fat tissue. in the brain, npy is produced in various locations including the hypothalamus. npy has several functions: increasing food intake and storage of energy as fat, reducing anxiety and stress, reducing pain perception, affecting circadian rhythm, reducing voluntary alcohol intake, lowering blood pressure, and controling epileptic seizures. npy has been studied for its role in obesity by interacting with the leptin receptor and neuropeptide y receptors (y1 and y2). |
How to place a order:
1) Contact us at: Service@apichina.com ;2) Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3) Place us a purchaser order, we can send you a sales contract too if you need;
4) Start synthesis, and we will inform you the updates of synthesis in time;
5) Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6) Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them;
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.