| Synonyms | |
| Sequence | Ovine: H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Ile-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Asn-Arg-Gln-Gln-Gly-Glu-Arg-Asn-Gln-Glu-Gln-Gly-Ala-Lys-Val-Arg-Leu-NH2 or H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2 |
| Molecular Formula | C221H368N72O66S1 |
| Molecular Weight | 5121.9 g/mol |
| Purity | Purity > 95% by HPLC |
| Format | Each vial contains 1 mg of lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt. |
| Solubility | Distilled water for a solution up to 2 mg/ml, otherwise we recommend using acetonitrile. |
| Storage | Store at -20°C. The product is hygroscopic and must be protected from light. Product is guaranteed one year from the date of shipment. Following reconstitution, aliquot and store at -20°C. |
| description | the growth hormone-releasing factor (ghrf) is released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone. |
How to place a order：
1) Contact us at: Service@apichina.com ;2) Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3) Place us a purchaser order, we can send you a sales contract too if you need;
4) Start synthesis, and we will inform you the updates of synthesis in time;
5) Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6) Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them;
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.