| Synonyms | |
| Sequence | Human: H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2 or H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2 |
| Molecular Formula | C215H358N72O66S1 |
| Molecular Weight | 5039.7 g/mol |
| Purity | Purity > 95% by HPLC |
| Format | Each vial contains 1 mg of lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt. |
| Solubility | Distilled water for a solution up to 2 mg/ml, otherwise we recommend using acetonitrile. |
| Storage | Store at -20°C. The product is hygroscopic and must be protected from light. Product is guaranteed one year from the date of shipment. Following reconstitution, aliquot and store at -20°C. |
| description | the growth hormone-releasing factor (ghrf) is released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone. ghrh is available under the names groliberin (pharmacia), somatrel (ferring) and geref (acetylated aa 1-29, serono) for the treatment of growth hormone deficiency. |
How to place a order:
1) Contact us at: Service@apichina.com ;2) Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3) Place us a purchaser order, we can send you a sales contract too if you need;
4) Start synthesis, and we will inform you the updates of synthesis in time;
5) Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6) Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them;
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.