| Synonyms | |
| Sequence | Ovine: H-Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2 or H-SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2 |
| Molecular Formula | C205H339N59O63S |
| Molecular Weight | 4370.41 g/mol |
| Purity | Purity > 95% by HPLC |
| Format | Each vial contains 1 mg of lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt. |
| Solubility | Distilled water for a solution up to 2 mg/ml, otherwise we recommend using acetonitrile. |
| Storage | Store at -20°C. The product is hygroscopic and must be protected from light. Product is guaranteed one year from the date of shipment. Following reconstitution, aliquot and store at -20°C. |
| description | corticotropin releasing factor (crf), a hormone from the hypothalamus, regulates the release of corticotropin (acth) and endorphin from the pituitary gland. crf is also a neurotransmitter in the central nervous system, and is involved in autonomic and endocrine responses to stress. |
How to place a order:
1) Contact us at: Service@apichina.com ;2) Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3) Place us a purchaser order, we can send you a sales contract too if you need;
4) Start synthesis, and we will inform you the updates of synthesis in time;
5) Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6) Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them;
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.